PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022347-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 344aa    MW: 38995.8 Da    PI: 5.8236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022347-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.9e-081444131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     rg+W+  Ed++l d++k++G g+W++ +++ 
    NNU_022347-RA 14 RGAWSVVEDQILMDYIKLHGEGNWRSLPQKA 44
                     89************************99876 PP

2Myb_DNA-binding45.61.7e-1491134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + +E+el+++++k+lG++ W++I  +++ gRt++++k++w++
    NNU_022347-RA  91 RGNISHDEEELILRLHKLLGNR-WSLITGRLP-GRTDNEIKNYWNT 134
                      78999*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-18588IPR009057Homeodomain-like
PROSITE profilePS500908.722985IPR017877Myb-like domain
SuperFamilySSF466895.72E-2112132IPR009057Homeodomain-like
SMARTSM007172.4E-61387IPR001005SANT/Myb domain
PfamPF002491.1E-71485IPR001005SANT/Myb domain
CDDcd001674.96E-41685No hitNo description
PROSITE profilePS5129422.59786140IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2289138IPR009057Homeodomain-like
SMARTSM007175.5E-1390138IPR001005SANT/Myb domain
PfamPF002491.8E-1291134IPR001005SANT/Myb domain
CDDcd001671.47E-995136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRRPCCSKE GLNRGAWSVV EDQILMDYIK LHGEGNWRSL PQKAVYKLKP YQQLSNVLKS  60
EYTSPIIPGL NRCGKSSRLR WLNYLRPDIK RGNISHDEEE LILRLHKLLG NRWSLITGRL  120
PGRTDNEIKN YWNTKLGKRK RDHPSSSSAP NSKHSKQSEN EKNEPIDELS AGQPKITTLV  180
RTKASRCTKI FIVPTQPRDH HQVEEIDDAN AAVIPPPNPM VDSLVTQKAV ESEPCSNGLS  240
SLTTPVEDNS LDFIMNLNVG DLCLSELLGS EFSQLWNPHD DHEMIEESKI NGDNDNWLCP  300
SLDQSIIYTD VMPEDWTRIN YVETRDDTVL HLGSLASFLD SGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-17121425109B-MYB
1h8a_C2e-171213925127MYB TRANSFORMING PROTEIN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241362.10.0PREDICTED: myb-related protein Myb4-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.18e-53myb domain protein 3